PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr9P05670_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family BES1
Protein Properties Length: 304aa    MW: 32507.2 Da    PI: 7.2199
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr9P05670_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822192.31.8e-59101271118
                 DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasa 88 
                            ++++r+ptw+ErEnnkrRERrRRaiaakiyaGLR++Gnyklpk++Dnn VlkALc+eAGw ve+DGttyrkg+kp e+ +++gssas 
  GSMUA_Achr9P05670_001  10 TSGTRMPTWRERENNKRRERRRRAIAAKIYAGLRMYGNYKLPKHCDNNAVLKALCEEAGWAVEEDGTTYRKGCKPVEHVDIVGSSASP 97 
                            5899************************************************************************************ PP

                 DUF822  89 spesslqsslkssalaspvesysaspksss 118
                            sp+ s++ s+ ss+lasp++s   + +++ 
  GSMUA_Achr9P05670_001  98 SPCVSYNPSPASSTLASPMSSTLITNAKNL 127
                            *******99999999999887655444333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056874.2E-5711144IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MKEGRVEEMT SGTRMPTWRE RENNKRRERR RRAIAAKIYA GLRMYGNYKL PKHCDNNAVL  60
KALCEEAGWA VEEDGTTYRK GCKPVEHVDI VGSSASPSPC VSYNPSPASS TLASPMSSTL  120
ITNAKNLTSG TEGNSLVPWL KSLSSASSTS TSSKLPDLHH LYVHGGSISA PVTPPLSSPT  180
ARSSRIKTDW DAPAIHPTWA GSNLTFLPSS MPPSPGHQDT PQSAWLASLR LPSGGPSSPT  240
FSLISSNPLM SDGGSDEFEF GSSSNGTDTA TGLVKPWEGE MIHEECASDE LDLTLGSSKT  300
RSVA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP7214908e-90KP721490.1 Eucalyptus grandis brassinazole-resistant 1 protein (BES3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009416433.10.0PREDICTED: protein BZR1 homolog 3
SwissprotQ5Z9E51e-110BZR3_ORYSJ; Protein BZR1 homolog 3
TrEMBLM0TXS60.0M0TXS6_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr9P05670_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP136638112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.13e-78BES1/BZR1 homolog 4